CCDC28A Antibody - middle region : FITC

CCDC28A Antibody - middle region : FITC
SKU
AVIARP55253_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is located in a region close to the locus of the pseudogene of chemokine (C-C motif) receptor-like 1 on chromosome 6. The specific function of this gene has not yet been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCDC28A

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: ERGLLSLLNDFHSGKLQAFGNECSIEQMEHVRGMQEKLARLNLELYGELE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil domain-containing protein 28A

Protein Size: 274

Purification: Affinity Purified
More Information
SKU AVIARP55253_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55253_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 25901
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×