CCDC70 Antibody - middle region : Biotin

CCDC70 Antibody - middle region : Biotin
SKU
AVIARP53804_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of CCDC70 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCDC70

Key Reference: Suzuki,Y., (2004) Genome Res. 14 (9), 1711-1718

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: TFRGKIHAFRGQILGFWEEERPFWEEEKTFWKEEKSFWEMEKSFREEEKT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil domain-containing protein 70

Protein Size: 233

Purification: Affinity Purified
More Information
SKU AVIARP53804_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53804_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 83446
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×