CCDC70 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of CCDC70 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCDC70

Key Reference: Suzuki,Y., (2004) Genome Res. 14 (9), 1711-1718

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: TFRGKIHAFRGQILGFWEEERPFWEEEKTFWKEEKSFWEMEKSFREEEKT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Coiled-coil domain-containing protein 70

Protein Size: 233

Purification: Affinity Purified

• SKU: AVIARP53804_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53804_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 83446
• Host: Rabbit
• Conjugate: Conjugated, HRP