CCIN Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: CCIN is a basic protein of the sperm head cytoskeleton. This protein contains kelch repeats and a BTB/POZ domain and is necessary for normal morphology during sperm differentiation.The protein encoded by this gene is a basic protein of the sperm head cytoskeleton. This protein contains kelch repeats and a BTB/POZ domain and is necessary for normal morphology during sperm differentiation. This gene is intronless.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CCIN

Key Reference: Lecuyer,C., (2000) Biol. Reprod. 63 (6), 1801-1810

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: TTSVPVLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Calicin

Protein Size: 588

Purification: Affinity Purified

• SKU: AVIARP53646_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53646_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 881
• Host: Rabbit
• Conjugate: Conjugated, HRP