CCIN Antibody - N-terminal region : Biotin

CCIN Antibody - N-terminal region : Biotin
SKU
AVIARP53645_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: CCIN is a basic protein of the sperm head cytoskeleton. This protein contains kelch repeats and a BTB/POZ domain and is necessary for normal morphology during sperm differentiation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCIN

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: VAYSGIRDNFHYWASPEGSMHFMRCPPVIFGRLLRDENLHVLNEDQALSA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calicin

Protein Size: 588

Purification: Affinity Purified
More Information
SKU AVIARP53645_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53645_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 881
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×