Cdk5 Antibody - middle region : FITC

Cdk5 Antibody - middle region : FITC
SKU
AVIARP54260_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Serine/threonine kinase is involved in synaptic regulation and neuronal development, phosphorylates synaptic protein Pctaire1 and regulates acetylcholine receptor expression.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Cdk5

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: EIVKSLLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cyclin-dependent kinase 5

Protein Size: 292

Purification: Affinity Purified
More Information
SKU AVIARP54260_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54260_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 140908
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×