Cdk5rap1 Antibody - C-terminal region : FITC

Cdk5rap1 Antibody - C-terminal region : FITC
SKU
AVIARP56907_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Cdk5rap1 is a probable regulator of CDK5 activity. It may inhibit CDK5 function via its interaction with CDK5R1.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: VIFPDAEVEDITDPGLKVRAQPGDYVLVKIISASSQTLKGHILCRTTMKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: CDK5 regulatory subunit-associated protein 1

Protein Size: 586

Purification: Affinity Purified

Subunit: -associated protein 1
More Information
SKU AVIARP56907_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56907_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 252827
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×