CDKL2 Antibody - N-terminal region : HRP

CDKL2 Antibody - N-terminal region : HRP
SKU
AVIARP58606_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of the protein remains unknown.This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the cytoplasm, with lower levels in the nucleus.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CDKL2

Key Reference: Marracci,G.H., (2006) Biochem. Biophys. Res. Commun. 344 (3), 963-971

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cyclin-dependent kinase-like 2

Protein Size: 493

Purification: Affinity Purified
More Information
SKU AVIARP58606_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58606_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 8999
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×