Cdkn3 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Cdkn3 may play a role in cell cycle regulation. It has dual specificity phosphatase active toward substrates containing either phosphotyrosine or phosphoserine residues. It dephosphorylates CDK2 at 'Thr-160' in a cyclin-dependent manner.

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: LKSYGIQDVFVFCTRGELSKYRVPNLLDLYQQYGIVTHHHPIPDGGTPDI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cyclin-dependent kinase inhibitor 3

Protein Size: 211

Purification: Affinity Purified

• SKU: AVIARP53628_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53628_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 72391
• Host: Rabbit
• Conjugate: Conjugated, HRP