CELA2A Antibody - C-terminal region : Biotin

CELA2A Antibody - C-terminal region : Biotin
SKU
AVIARP57698_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Like most of the human elastases, elastase 2A is secreted from the pancreas as a zymogen. In other species, elastase 2A has been shown to preferentially cleave proteins after leucine, methionine, and phenylalanine residues.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CEL2A

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: CNGDSGGPLNCQASDGRWQVHGIVSFGSRLGCNYYHKPSVFTRVSNYIDW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: chymotrypsin-like elastase family member 2A

Protein Size: 269

Purification: Affinity Purified
More Information
SKU AVIARP57698_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57698_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 63036
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×