CENPI Antibody - N-terminal region : FITC

CENPI Antibody - N-terminal region : FITC
SKU
AVIARP54806_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The product of this gene is involved in the response of gonadal tissues to follicle-stimulating hormone. This gene is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CENPI

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: SKNISKHGQNNPVGDYEHADDQAEEDALQMAVGYFEKGPIKASQNKDKTL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Centromere protein I

Protein Size: 522

Purification: Affinity Purified
More Information
SKU AVIARP54806_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54806_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Dog (Canine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2491
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×