CENPP Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: CENPP is the component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. CENPP may be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.CENPP is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006 [PubMed 16622420]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1104 CR592049.1 1-1104 1105-1633 BC071726.1 622-1150 1634-1689 BX537851.1 972-1027 1690-3411 AK091247.1 839-2560 3412-3428 AL833701.1 3078-3094

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CENPP

Key Reference: Okada,M., (2006) Nat. Cell Biol. 8 (5), 446-457

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: VQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Centromere protein P

Protein Size: 288

Purification: Affinity Purified

• SKU: AVIARP54412_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54412_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 401541
• Host: Rabbit
• Conjugate: Conjugated, Biotin