CFAP157 Antibody - N-terminal region : HRP

CFAP157 Antibody - N-terminal region : HRP
SKU
AVIARP54415_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C9orf117

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: LAKEMEKDAFEAQLAQVRHEFQETKDQLTTENIILGGKLAALEEFRLQKE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cilia- and flagella-associated protein 157

Protein Size: 520

Purification: Affinity Purified
More Information
SKU AVIARP54415_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54415_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 286207
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×