CFHR2 Antibody - C-terminal region : HRP

CFHR2 Antibody - C-terminal region : HRP
SKU
AVIARP54784_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: CFHR2 might be involved in complement regulation. It can associate with lipoproteins and may play a role in lipid metabolism.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CFHR2

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: KLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Complement factor H-related protein 2

Protein Size: 243

Purification: Affinity Purified
More Information
SKU AVIARP54784_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54784_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rabbit
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3080
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×