CHKA Antibody - middle region : Biotin

CHKA Antibody - middle region : Biotin
SKU
AVIARP53583_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. CHKA is the initial enzyme in the sequence and may play a regulatory role. It also catalyzes the phosphorylation of ethanolamine.The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. The protein encoded by this gene is the initial enzyme in the sequence and may play a regulatory role. The encoded protein also catalyzes the phosphorylation of ethanolamine. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHKA

Key Reference: Glunde,K., (2008) Cancer Res. 68 (1), 172-180

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Choline kinase alpha

Protein Size: 457

Purification: Affinity Purified
More Information
SKU AVIARP53583_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53583_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 1119
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×