CHMP1B Antibody - N-terminal region : Biotin

CHMP1B Antibody - N-terminal region : Biotin
SKU
AVIARP57408_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: CHMP1B belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHMP1B

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Charged multivesicular body protein 1b

Protein Size: 199

Purification: Affinity Purified
More Information
SKU AVIARP57408_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57408_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57132
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×