Chmp2b Antibody - N-terminal region : Biotin

Chmp2b Antibody - N-terminal region : Biotin
SKU
AVIARP54967_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Chmp2b is involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Chmp2b recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Chmp2b redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. In conjunction with the ESCRT machinery Chmp2b also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis. Involved in cytokinesis .

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Chmp2b

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: ASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 213

Purification: Affinity Purified
More Information
SKU AVIARP54967_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54967_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 363720
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×