CHORDC1 Antibody - middle region : Biotin

CHORDC1 Antibody - middle region : Biotin
SKU
AVIARP54844_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: CHORDC1 may be play a role in the regulation of NOD1 via its interaction with HSP90AA1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHORDC1

Key Reference: Shirasu,K., (1999) Cell 99 (4), 355-366

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: SGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cysteine and histidine-rich domain-containing protein 1

Protein Size: 332

Purification: Affinity Purified
More Information
SKU AVIARP54844_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54844_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26973
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×