CHORDC1 Antibody - middle region : HRP

CHORDC1 Antibody - middle region : HRP
SKU
AVIARP54844_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: CHORDC1 may be play a role in the regulation of NOD1 via its interaction with HSP90AA1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHORDC1

Key Reference: Shirasu,K., (1999) Cell 99 (4), 355-366

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: SGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cysteine and histidine-rich domain-containing protein 1

Protein Size: 332

Purification: Affinity Purified
More Information
SKU AVIARP54844_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54844_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26973
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×