CLMN Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CLMN is a single-pass type IV membrane protein. It contains 1 actin-binding domain and 2 CH (calponin-homology) domains. The exact function of CLMN remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CLMN

Key Reference: Heilig,R., (2003) Nature 421 (6923), 601-607

Molecular Weight: 110kDa

Peptide Sequence: Synthetic peptide located within the following region: LEENVTKESISSKKKEKRKHVDHVESSLFVAPGSVQSSDDLEEDSSDYSI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calmin

Protein Size: 1002

Purification: Affinity Purified

• SKU: AVIARP53774_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53774_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Pig (Porcine), Dog (Canine), Cow (Bovine), Yeast
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 79789
• Host: Rabbit
• Conjugate: Conjugated, FITC