CLUAP1 Antibody - C-terminal region : HRP

CLUAP1 Antibody - C-terminal region : HRP
SKU
AVIARP55150_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: CLUAP1 may play a role in cell proliferation or apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CLUAP1

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: RIVGTMQGGDSDDNEDSEESEIDMEDDDDEDDDLEDESISLSPTKPNRRV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Clusterin-associated protein 1

Protein Size: 413

Purification: Affinity Purified
More Information
SKU AVIARP55150_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55150_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23059
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×