CNDP2 Antibody - middle region : Biotin

CNDP2 Antibody - middle region : Biotin
SKU
AVIARP57167_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: CNDP2, also known as tissue carnosinase and peptidase A (EC 3.4.13.18), is a nonspecific dipeptidase rather than a selective carnosinase (Teufel et al., 2003 [PubMed 12473676]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CNDP2

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: ALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytosolic non-specific dipeptidase

Protein Size: 475

Purification: Affinity Purified
More Information
SKU AVIARP57167_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57167_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55748
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×