CNOT4 Antibody - middle region : FITC

CNOT4 Antibody - middle region : FITC
SKU
AVIARP57877_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CNOT4 has E3 ubiquitin ligase activity. The CCR4-NOT complex functions as general transcription regulation complex.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CNOT4

Key Reference: Winkler,G.S., (2004) J. Mol. Biol. 337 (1), 157-165

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: AGIPASSGNSLDSLQDDNPPHWLKSLQALTEMDGPSAAPSQTHHSAPFST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: CCR4-NOT transcription complex subunit 4

Protein Size: 639

Purification: Affinity Purified

Subunit: 4
More Information
SKU AVIARP57877_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57877_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4850
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×