CNOT4 Antibody - middle region : HRP

CNOT4 Antibody - middle region : HRP
SKU
AVIARP57877_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: CNOT4 has E3 ubiquitin ligase activity. The CCR4-NOT complex functions as general transcription regulation complex.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CNOT4

Key Reference: Winkler,G.S., (2004) J. Mol. Biol. 337 (1), 157-165

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: AGIPASSGNSLDSLQDDNPPHWLKSLQALTEMDGPSAAPSQTHHSAPFST

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: CCR4-NOT transcription complex subunit 4

Protein Size: 639

Purification: Affinity Purified

Subunit: 4
More Information
SKU AVIARP57877_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57877_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4850
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×