COPG Antibody - N-terminal region : Biotin

COPG Antibody - N-terminal region : Biotin
SKU
AVIARP55336_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COPG

Molecular Weight: 98kDa

Peptide Sequence: Synthetic peptide located within the following region: MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coatomer subunit gamma-1

Protein Size: 874

Purification: Affinity Purified

Subunit: gamma
More Information
SKU AVIARP55336_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55336_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 22820
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×