Cops4 Antibody - N-terminal region : HRP

Cops4 Antibody - N-terminal region : HRP
SKU
AVIARP56840_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rat homolog is a member of the COP9 complex, which may act as a regulator of cell signaling pathways.

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: VNENVSLVISRQLLTDFCTHLPNLPDSTAKEVYHFTLEKVQPRVISFEEQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: COP9 signalosome complex subunit 4

Protein Size: 406

Purification: Affinity Purified

Subunit: 4
More Information
SKU AVIARP56840_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56840_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 360915
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×