COX18 Antibody - middle region : HRP

COX18 Antibody - middle region : HRP
SKU
AVIARP55716_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: COX18 is required for the insertion of integral membrane proteins into the mitochondrial inner membrane. COX18 is essential for the activity and assembly of cytochrome c oxidase. COX18 plays a central role in the translocation and export of the C-terminal part of the COX2 protein into the mitochondrial intermembrane space.COX18 encodes a cytochrome c oxidase (COX)-assembly protein. The S. cerevisiae Cox18 protein catalyzes the insertion of the Cox2 (MTCO2; MIM 516040) C-terminal tail into the mitochondrial inner membrane, an intermediate step in the assembly of complex IV of the mitochondrial respiratory chain (Sacconi et al., 2005 [PubMed 16212937]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1248 AY957565.1 1-1248 1249-4523 AC095053.3 75071-78345 c

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human COX18

Key Reference: Gaisne,M. (2006) FEMS Yeast Res. 6 (6), 869-882

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: LCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mitochondrial inner membrane protein COX18

Protein Size: 333

Purification: Affinity Purified
More Information
SKU AVIARP55716_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55716_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 285521
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×