CPEB3 Antibody - middle region : Biotin

CPEB3 Antibody - middle region : Biotin
SKU
AVIARP55103_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The exact function of CPEB3 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPEB3

Key Reference: Heilig,R., (2006) Science 313 (5794), 1788-1792

Molecular Weight: 76kDa

Peptide Sequence: Synthetic peptide located within the following region: RTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGKHYPPSG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytoplasmic polyadenylation element-binding protein 3

Protein Size: 698

Purification: Affinity Purified
More Information
SKU AVIARP55103_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55103_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 22849
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×