Cpne2 Antibody - N-terminal region : HRP

Cpne2 Antibody - N-terminal region : HRP
SKU
AVIARP55509_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encodes a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Cpne2

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: QCCVCKVELSVSGQNLLDRDVTSKSDPFCVLFIEDNGRWMEFDRTETAVN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Copine-2

Protein Size: 548

Purification: Affinity Purified
More Information
SKU AVIARP55509_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55509_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 234577
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×