CPXM1 Antibody - middle region : Biotin

CPXM1 Antibody - middle region : Biotin
SKU
AVIARP57346_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene likely encodes a member of the carboxypeptidase family of proteins. Cloning of a comparable locus in mouse indicates that the encoded protein contains a discoidin domain and a carboxypeptidase domain, but the protein appears to lack residues necessary for carboxypeptidase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPXM1

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: MNDFSYLHTNCFEVTVELSCDKFPHENELPQEWENNKDALLTYLEQVRMG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable carboxypeptidase X1

Protein Size: 734

Purification: Affinity Purified
More Information
SKU AVIARP57346_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57346_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56265
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×