CPXM1 Antibody - middle region : HRP

CPXM1 Antibody - middle region : HRP
SKU
AVIARP57346_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene likely encodes a member of the carboxypeptidase family of proteins. Cloning of a comparable locus in mouse indicates that the encoded protein contains a discoidin domain and a carboxypeptidase domain, but the protein appears to lack residues necessary for carboxypeptidase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPXM1

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: MNDFSYLHTNCFEVTVELSCDKFPHENELPQEWENNKDALLTYLEQVRMG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Probable carboxypeptidase X1

Protein Size: 734

Purification: Affinity Purified
More Information
SKU AVIARP57346_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57346_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56265
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×