CREM Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CREM

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: GVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYTATGDMPTYQIRAP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cAMP-responsive element modulator

Protein Size: 237

Purification: Affinity Purified

• SKU: AVIARP53594_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53594_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 1390
• Host: Rabbit
• Conjugate: Conjugated, Biotin