CRISP1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. CRISP1 is a member of the cysteine-rich secretory protein (CRISP) family. It is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head where it plays a role at fertilization in sperm-egg fusion through complementary sites localized on the egg surface.

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: ARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSWSSVIGVWYSEST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cysteine-rich secretory protein 1

Protein Size: 249

Purification: Affinity Purified

• SKU: AVIARP53581_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53581_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 167
• Host: Rabbit
• Conjugate: Conjugated, Biotin