CSNK2A2 Antibody - C-terminal region : HRP

CSNK2A2 Antibody - C-terminal region : HRP
SKU
AVIARP53595_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: CSNK2A2 belongs to the protein kinase superfamily, Ser/Thr protein kinase family, CK2 subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha and alpha' chains contain the catalytic site. CSNK2A2 participates in Wnt signaling. It phosphorylates 'Ser-392' of p53/TP53 following UV irradiation.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CSNK2A2

Key Reference: Gottlieb,D.J., (er) BMC Med. Genet. 8 SUPPL 1, S9 (2007)

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Casein kinase II subunit alpha'

Protein Size: 350

Purification: Affinity Purified

Subunit: alpha'
More Information
SKU AVIARP53595_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53595_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 1459
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×