Cst6 Antibody - middle region : Biotin

Cst6 Antibody - middle region : Biotin
SKU
AVIARP53533_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of Cst6 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human Cst6

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: CGELIPPPPPSYRLSLTLTSPLSTAAKELVLIPLHAAPNQAVAEIDALYD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cystatin E/M EMBL AAH61036.1

Protein Size: 149

Purification: Affinity Purified
More Information
SKU AVIARP53533_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53533_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 73720
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×