CUTC Antibody - middle region : FITC

CUTC Antibody - middle region : FITC
SKU
AVIARP56791_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper (Gupta et al., 1995 [PubMed 7635807]; Li et al., 2005 [PubMed 16182249]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CUTC

Key Reference: Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: LEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Copper homeostasis protein cutC homolog

Protein Size: 273

Purification: Affinity Purified
More Information
SKU AVIARP56791_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56791_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51076
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×