CYB5RL Antibody - N-terminal region : Biotin

CYB5RL Antibody - N-terminal region : Biotin
SKU
AVIARP56230_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC606495

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: KLNPETFVAFCIIAMDRLTKDTYRVRFALPGNSQLGLRPGQHLILRGIVD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NADH-cytochrome b5 reductase-like

Protein Size: 315

Purification: Affinity Purified
More Information
SKU AVIARP56230_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56230_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 606495
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×