CYB5RL Antibody - N-terminal region : HRP

CYB5RL Antibody - N-terminal region : HRP
SKU
AVIARP56230_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC606495

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: KLNPETFVAFCIIAMDRLTKDTYRVRFALPGNSQLGLRPGQHLILRGIVD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NADH-cytochrome b5 reductase-like

Protein Size: 315

Purification: Affinity Purified
More Information
SKU AVIARP56230_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56230_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 606495
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×