CYP20A1 Antibody - N-terminal region : Biotin

CYP20A1 Antibody - N-terminal region : Biotin
SKU
AVIARP57758_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein lacks

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CYP20A1

Key Reference: Jiang,J.H., (2004) Ai Zheng 23 (6), 672-677

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: ITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytochrome P450 20A1

Protein Size: 462

Purification: Affinity Purified
More Information
SKU AVIARP57758_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57758_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57404
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×