CYP4X1 Antibody - middle region : HRP

CYP4X1 Antibody - middle region : HRP
SKU
AVIARP55763_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of the protein remains unknown.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The expression pattern of a similar rat protein suggests that this protein may be involved in neurovascular function in the brain.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP4X1

Key Reference: Savas,U., (2005) Arch. Biochem. Biophys. 436 (2), 377-385

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: LDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cytochrome P450 4X1

Protein Size: 509

Purification: Affinity Purified
More Information
SKU AVIARP55763_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55763_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 260293
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×