DAPK1 Antibody - N-terminal region : HRP

DAPK1 Antibody - N-terminal region : HRP
SKU
AVIARP58219_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 160-kD calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consen

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DAPK1

Molecular Weight: 157kDa

Peptide Sequence: Synthetic peptide located within the following region: MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Death-associated protein kinase 1

Protein Size: 1431

Purification: Affinity Purified
More Information
SKU AVIARP58219_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58219_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 1612
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×