DBNL Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: DBNL is an actin-binding adapter protein. DBNL may act as a common effector of antigen receptor-signaling pathways in leukocytes. Its association with dynamin suggests that it may also connect the actin cytoskeleton to endocytic function. DBNL acts as a k

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DBNL

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: QESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Drebrin-like protein

Protein Size: 430

Purification: Affinity Purified

• SKU: AVIARP54437_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54437_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Dog (Canine), Guinea Pig
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 28988
• Host: Rabbit
• Conjugate: Conjugated, HRP