DBP Antibody - C-terminal region : Biotin

DBP Antibody - C-terminal region : Biotin
SKU
AVIARP57959_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: DBP is a member of the PAR bZIP (proline and acidic amino acid-rich basic leucine zipper) transcription factor family. It is transcriptional activator that recognizes and binds to the sequence 5'-RTTAYGTAAY-3' found in the promoter of genes such as albumin, CYP2A4 and CYP2A5. The protein is not essential for circadian rhythm generation, but modulates important clock output genes.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DBP

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: FSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: D site-binding protein

Protein Size: 325

Purification: Affinity Purified
More Information
SKU AVIARP57959_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57959_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 1628
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×