DDHD2 Antibody - N-terminal region : Biotin

DDHD2 Antibody - N-terminal region : Biotin
SKU
AVIARP55202_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: DDHD2 is a phospholipase that hydrolyzes preferentially phosphatidic acid and phosphatidylethanolamine.DDHD2 may be involved in the maintenance of the endoplasmic reticulum and/or Golgi structures.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DDHD2

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: DGWGSTPTEQGRPRTVKRGVENISVDIHCGEPLQIDHLVFVVHGIGPACD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phospholipase DDHD2

Protein Size: 711

Purification: Affinity Purified
More Information
SKU AVIARP55202_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55202_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23259
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×