DDI1 Antibody - middle region : HRP

DDI1 Antibody - middle region : HRP
SKU
AVIARP56142_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DDI1

Key Reference: Puente,X.S. (2004) Genome Res. 14 (4), 609-622

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: KNVLVIGTTGTQTYFLPEGELPLCSRMVSGQDESSDKEITHSVMDSGRKE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein DDI1 homolog 1

Protein Size: 396

Purification: Affinity Purified
More Information
SKU AVIARP56142_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56142_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 414301
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×