Dennd1a Antibody - C-terminal region : HRP

Dennd1a Antibody - C-terminal region : HRP
SKU
AVIARP57502_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Dennd1a is a guanine nucleotide exchange factor (GEF) for RAB35. It may be involved in the clathrin-mediated endocytosis of synaptic vesicles.

Molecular Weight: 111kDa

Peptide Sequence: Synthetic peptide located within the following region: QPLGQAKSLEDLRAPKDLREQPGSFDYQRLDLCRSERGLSMAAALKLAHP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DENN domain-containing protein 1A

Protein Size: 1016

Purification: Affinity Purified
More Information
SKU AVIARP57502_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57502_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 227801
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×