DENND2C Antibody - middle region : HRP

DENND2C Antibody - middle region : HRP
SKU
AVIARP53471_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of DENND2C is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DENND2C

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 100kDa

Peptide Sequence: Synthetic peptide located within the following region: DIFESKRGKKKVKLHSYTGKELPPTKGETSGNESDAEYLPKNRHKRLAQL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DENN domain-containing protein 2C

Protein Size: 871

Purification: Affinity Purified
More Information
SKU AVIARP53471_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53471_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 163259
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×