DGKA Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important rol

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DGKA

Molecular Weight: 83kDa

Peptide Sequence: Synthetic peptide located within the following region: EGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSEL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Diacylglycerol kinase alpha

Protein Size: 735

Purification: Affinity Purified

• SKU: AVIARP53483_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53483_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 1606
• Host: Rabbit
• Conjugate: Conjugated, FITC