DHRS9 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: DHRS9 is a 3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone. DHRS9 may play a role in the biosynthesis of retinoic acid from r

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DHRS9

Key Reference: Jones,R.J., (2007) J. Biol. Chem. 282 (11), 8317-8324

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Dehydrogenase/reductase SDR family member 9

Protein Size: 319

Purification: Affinity Purified

• SKU: AVIARP53475_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53475_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10170
• Host: Rabbit
• Conjugate: Conjugated, FITC