Dipk2a Antibody - N-terminal region : Biotin

Dipk2a Antibody - N-terminal region : Biotin
SKU
AVIARP55633_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse 1190002N15Rik

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: FLNVKNVYFAQYGEPREGGRRRVVLKRLGSQRELAQLDQSICKRATGRPR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Deleted in autism protein 1 homolog

Protein Size: 444

Purification: Affinity Purified
More Information
SKU AVIARP55633_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55633_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 68861
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×